PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 281aa    MW: 31984.7 Da    PI: 4.8528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++  G g+W++ ++  g+ R++k+c++rw +yl
   XP_009629052.1 14 KGPWTPEEDQILVSYIQTNGHGNWRALPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   XP_009629052.1  67 RGNFTREEEDSIIQLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.528961IPR017930Myb domain
SuperFamilySSF466898.8E-3110108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002497.4E-161461IPR001005SANT/Myb domain
CDDcd001677.45E-111661No hitNo description
PROSITE profilePS5129425.10862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2665117IPR009057Homeodomain-like
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
PfamPF002493.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.00E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILVSYIQ TNGHGNWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TREEEDSIIQ LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKNYQ  120
PPQNSKRHSK NNLDSKAPST SQTFNNSDNF SNIQEDINGP VTGPNSPQRS SSEMSTVTVD  180
STAMTTITID DQNMFKQLDE MDSSENFIPE IDESFWTDDL STSDNSTFGM EGTGGELQVQ  240
FPFSSVKQES MDMVGAKLED DMDFWYNVFI KSGDLLDLPE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-27121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
1mse_C4e-27121162105C-Myb DNA-Binding Domain
1msf_C4e-27121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0286490.0AB028649.1 Nicotiana tabacum gene for myb-related transcription factor LBM1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629052.10.0PREDICTED: myb-related protein Myb4-like
RefseqXP_016490215.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLQ9SLT20.0Q9SLT2_TOBAC; Myb-related transcription factor LBM1
STRINGPGSC0003DMT4000443621e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.17e-94myb domain protein 15